PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI06G21880.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 440aa    MW: 48248.9 Da    PI: 4.6058
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI06G21880.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.8e-1978125148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT++Ed++l ++v+ +G g+W+++ r  g++R++k+c++rw ++l
  ORUFI06G21880.2  78 KGPWTPDEDKRLREYVEAHGEGNWNRVQRNAGLNRCGKSCRLRWANHL 125
                      79******************************************9986 PP

2Myb_DNA-binding42.51.5e-13131174146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+e +++++  lG++ W++ a+ ++ gRt++++k++w++
  ORUFI06G21880.2 131 KGPFSKEEEEMIIKLHLWLGNK-WAKMANSLP-GRTDNEIKNFWNT 174
                      79********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.63973129IPR017930Myb domain
SuperFamilySSF466892.13E-3075172IPR009057Homeodomain-like
SMARTSM007175.2E-1677127IPR001005SANT/Myb domain
PfamPF002493.5E-1778125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2479132IPR009057Homeodomain-like
CDDcd001673.34E-1280125No hitNo description
SMARTSM007171.9E-12130178IPR001005SANT/Myb domain
PROSITE profilePS5129416.24130180IPR017930Myb domain
PfamPF002493.3E-12131174IPR001005SANT/Myb domain
CDDcd001679.95E-10133174No hitNo description
Gene3DG3DSA:1.10.10.606.9E-24133178IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MEGSSPMEEE EEAARLAGSQ GESPAMLHPN GDGDGDGGDD EGDASGGEEE QGGVARAGVR  60
RRGGGGRVRV RGRIPLKKGP WTPDEDKRLR EYVEAHGEGN WNRVQRNAGL NRCGKSCRLR  120
WANHLKPDLK KGPFSKEEEE MIIKLHLWLG NKWAKMANSL PGRTDNEIKN FWNTRCKRIQ  180
RTGEPLYPKE FNHFKLTDLE VMNCESPDES RAKKRTNEVL QGNGQIDATS PFGSAIATQD  240
QSVPFGSAIV SGHPILDGNF STSGTIQRPM NVELPSLQYP NYDFNNNNAW SYHDPLGHPI  300
DQVDFGSLRS EYLSPNNNGL LDALVHGGHG QGELANSQGS FDACFPRVQC NQVIQSNAFS  360
LSSSFPIIGD DLLENIYCQF NEELPPSNEQ FAKDADDAFG HGGLSDETNL AAAGQGDEHD  420
LEDPWASMPG ACDIPDFPSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27761785106B-MYB
1h8a_C2e-277617825126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2120750.0AB212075.1 Oryza sativa Japonica Group mRNA for GAMYB-like1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641123.10.0PREDICTED: transcription factor GAMYB
TrEMBLA0A0E0PZX80.0A0A0E0PZX8_ORYRU; Uncharacterized protein
STRINGLOC_Os06g40330.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.23e-56myb domain protein 101